<?xml version="1.0"?>
<bioml xmlns:GAML="http://www.bioml.com/gaml/" label="models from 'C:\Xtandem_WorkDir\QC_Shew_07_02_0p5uguL-a_16Oct07_Owl_07-08-02_dta.txt'">
<group id="10745" mh="2314.835000" z="2" expect="8.4e-005" label="SO_1630 translation elongation factor Ts (Tsf)" type="model" sumI="5.29" maxI="22514.9" fI="225.149" >
<protein expect="-137.0" id="10745.1" uid="1370" label="SO_1630 translation elongation factor Ts (Tsf)" sumI="6.79" >
<note label="description">SO_1630 translation elongation factor Ts (Tsf)</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="283">
	<domain id="10745.1.1" start="191" end="211" expect="8.4e-005" mh="2314.159" delta="0.676" hyperscore="36.4" nextscore="21.8" y_score="12.2" y_ions="8" b_score="8.7" b_ions="4" pre="VVAR" post="MVVG" seq="EQALQIEISMNEGKPADIAEK" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="10745.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.60936</GAML:attribute>
<GAML:attribute type="a1">-0.266291</GAML:attribute>
<GAML:Xdata label="10745.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="38">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="10745.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="38">
7922 7922 7922 7922 7557 6417 5382 3923 2715 1693 1057 572 322 180 89 35 15 7 0 0 0 0 5 0 0 0 0 0 0 0
0 0 0 0 0 0 3 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="10745.convolute" type="convolution survival function">
<GAML:Xdata label="10745.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="15">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="10745.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="15">
7927 7927 7927 7927 7562 6422 5231 3521 2005 833 336 72 11 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="10745.b" type="b ion histogram">
<GAML:Xdata label="10745.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="8">
0 1 2 3 4 5 6 7 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="10745.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="8">
2736 3890 1074 201 25 0 1 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="10745.y" type="y ion histogram">
<GAML:Xdata label="10745.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
0 1 2 3 4 5 6 7 8 9 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="10745.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
2890 3802 1013 197 16 5 1 0 3 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=9161 cs=2</note>
<GAML:trace id="10745" label="10745.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">2314.84</GAML:attribute>
<GAML:attribute type="charge">2</GAML:attribute>
<GAML:Xdata label="10745.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
424.241 460.272 553.307 575.344 597.315 665.184 725.412 743.416 745.566 794.265 812.213 813.284 872.11 873.41 883.199 907.471 911.529 925.485 928.72 937.587 994.221 1012.29 1029.29 1043.54 1057.58 1084.37 1093.22 1116.39 1243.35 1261.63
1285.44 1302.6 1369.64 1373.52 1386.46 1389.52 1391.66 1503.76 1504.75 1572.66 1613.72 1631.67 1633.76 1728.85 1745.87 1746.87 1837.87 1855.79 1857 1969.52 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="10745.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
9 23 13 12 11 24 9 100 7 18 18 9 12 8 7 10 21 15 24 14 20 10 14 7 13 9 7 13 7 8
7 21 13 10 12 84 21 34 16 11 13 43 12 7 21 11 12 28 9 8 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="4837" mh="1102.528000" z="2" expect="1.7e-004" label="SO_1630 translation elongation factor Ts (Tsf)" type="model" sumI="5.05" maxI="21465.5" fI="214.655" >
<protein expect="-137.0" id="4837.1" uid="1370" label="SO_1630 translation elongation factor Ts (Tsf)" sumI="6.79" >
<note label="description">SO_1630 translation elongation factor Ts (Tsf)</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="283">
	<domain id="4837.1.1" start="256" end="265" expect="1.7e-004" mh="1101.615" delta="0.913" hyperscore="42.4" nextscore="23.1" y_score="12.0" y_ions="8" b_score="10.4" b_ions="6" pre="NFIR" post="EEDF" seq="LEVGEGIEKK" missed_cleavages="3">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="4837.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.44746</GAML:attribute>
<GAML:attribute type="a1">-0.217408</GAML:attribute>
<GAML:Xdata label="4837.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="44">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 39 40 41 42 43 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="4837.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="44">
12785 12785 12443 11705 9951 8567 6775 5438 4127 3021 2232 1480 834 566 296 159 96 58 33 13 5 2 0 9 0 0 0 0 0 0
0 0 0 0 0 0 0 0 0 0 0 0 5 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="4837.convolute" type="convolution survival function">
<GAML:Xdata label="4837.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="17">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="4837.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="17">
12794 12794 12452 11697 9849 8138 5956 4254 2961 1931 1338 632 277 83 25 5 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="4837.b" type="b ion histogram">
<GAML:Xdata label="4837.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="8">
0 1 2 3 4 5 6 7 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="4837.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="8">
3279 6417 2389 586 110 8 5 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="4837.y" type="y ion histogram">
<GAML:Xdata label="4837.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
0 1 2 3 4 5 6 7 8 9 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="4837.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
5303 5562 1604 299 16 4 1 0 5 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=5722 cs=2</note>
<GAML:trace id="4837" label="4837.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">1102.53</GAML:attribute>
<GAML:attribute type="charge">2</GAML:attribute>
<GAML:Xdata label="4837.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
197.166 215.115 240.206 243.039 257.381 275.142 300.175 343.298 352.358 380.927 386.318 399.05 404.255 421.35 430.457 431.417 449.368 486.049 494.954 500.485 506.614 510.265 517.579 522.372 524.162 567.463 574.351 585.319 670.357 680.453
685.274 695.779 698.598 703.442 713.41 732.529 742.472 760.458 762.539 792.105 800.354 809.434 827.331 828.331 841.502 859.481 861.487 955.318 973.334 988.356 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="4837.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
3 13 2 34 4 18 2 4 2 3 4 2 3 4 100 6 2 13 24 2 2 3 2 3 3 3 18 6 2 3
2 2 6 6 6 2 6 55 3 2 3 11 19 7 6 79 7 7 7 3 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="17689" mh="2732.762000" z="3" expect="1.7e-009" label="SO_1630 translation elongation factor Ts (Tsf)" type="model" sumI="5.49" maxI="23827.9" fI="238.279" >
<protein expect="-137.0" id="17689.1" uid="1370" label="SO_1630 translation elongation factor Ts (Tsf)" sumI="6.79" >
<note label="description">SO_1630 translation elongation factor Ts (Tsf)</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="283">
	<domain id="17689.1.1" start="256" end="281" expect="1.7e-009" mh="2732.399" delta="0.363" hyperscore="83.5" nextscore="32.1" y_score="12.3" y_ions="13" b_score="12.2" b_ions="16" pre="NFIR" post="KA]" seq="LEVGEGIEKKEEDFAAEVAAQIAASK" missed_cleavages="3">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="17689.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.7331</GAML:attribute>
<GAML:attribute type="a1">-0.173651</GAML:attribute>
<GAML:Xdata label="17689.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="86">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59
60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="17689.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="86">
11595 11595 11595 11595 11595 11285 10980 10374 9327 8062 6643 5183 3936 2920 2092 1490 1019 717 448 298 187 117 77 62 35 23 14 10 4 3
0 0 6 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="17689.convolute" type="convolution survival function">
<GAML:Xdata label="17689.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="17689.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
11601 11601 11601 11601 11601 11291 10959 10211 8562 6208 3583 1507 312 56 8 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="17689.b" type="b ion histogram">
<GAML:Xdata label="17689.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="18">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="17689.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="18">
1076 3337 3312 2275 1062 379 128 24 2 2 0 0 0 0 0 0 4 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="17689.y" type="y ion histogram">
<GAML:Xdata label="17689.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="15">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="17689.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="15">
1976 3986 3103 1658 602 214 51 5 1 1 0 0 0 4 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=13087 cs=3</note>
<GAML:trace id="17689" label="17689.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">2732.76</GAML:attribute>
<GAML:attribute type="charge">3</GAML:attribute>
<GAML:Xdata label="17689.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
376.293 617.315 671.512 688.437 698.24 717.053 729.018 759.37 760.481 777.389 802.58 816.819 825.4 827.455 831.311 838.238 841.201 849.009 852.384 858.391 859.587 864.612 866.399 873.644 885.666 892.729 955.937 978.657 987.609 1023.32
1050.07 1058.57 1076.64 1103.09 1122.74 1129.41 1147.6 1159.46 1170.55 1179.29 1180.4 1196.6 1214.94 1218.65 1244.06 1250.34 1276.65 1294.07 1347.55 1391.11 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="17689.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
9 9 11 37 12 10 32 95 23 9 25 10 16 10 29 40 9 11 11 58 32 9 8 39 9 18 12 17 100 52
9 97 9 23 22 40 17 11 11 43 11 12 85 9 11 32 44 17 13 10 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="5677" mh="973.690000" z="2" expect="4.1e-001" label="SO_1630 translation elongation factor Ts (Tsf)" type="model" sumI="5.42" maxI="90860.5" fI="908.605" >
<protein expect="-137.0" id="5677.1" uid="1370" label="SO_1630 translation elongation factor Ts (Tsf)" sumI="6.79" >
<note label="description">SO_1630 translation elongation factor Ts (Tsf)</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="283">
	<domain id="5677.1.1" start="256" end="264" expect="4.1e-001" mh="973.520" delta="0.170" hyperscore="29.2" nextscore="21.9" y_score="12.0" y_ions="5" b_score="10.3" b_ions="5" pre="NFIR" post="KEED" seq="LEVGEGIEK" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="5677.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.0624</GAML:attribute>
<GAML:attribute type="a1">-0.18665</GAML:attribute>
<GAML:Xdata label="5677.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="31">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="5677.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="31">
13717 13717 13415 11491 9577 7781 5831 4334 3327 2531 1923 1339 841 603 342 222 118 88 37 20 0 10 3 0 0 0 0 0 0 4
0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="5677.convolute" type="convolution survival function">
<GAML:Xdata label="5677.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="18">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="5677.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="18">
13727 13727 13275 11050 8643 6411 4052 2735 2019 1535 1148 559 420 86 17 10 3 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="5677.b" type="b ion histogram">
<GAML:Xdata label="5677.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="7">
0 1 2 3 4 5 6 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="5677.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="7">
3745 6457 2857 605 56 7 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="5677.y" type="y ion histogram">
<GAML:Xdata label="5677.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="7">
0 1 2 3 4 5 6 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="5677.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="7">
3688 6168 3081 681 97 12 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=6224 cs=2</note>
<GAML:trace id="5677" label="5677.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">973.69</GAML:attribute>
<GAML:attribute type="charge">2</GAML:attribute>
<GAML:Xdata label="5677.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="46">
152.074 175.128 180.122 197.221 215.198 217.234 227.041 228.981 232.26 242.988 246.046 251.19 258.168 260.184 285.243 299.126 316.259 322.18 328.177 342.231 356.221 357.196 366.364 371.178 379.957 386.43 388.186 399.034 424.26 429.858
442.337 444.412 446.309 452.294 460.563 575.415 586.297 632.33 681.373 698.432 731.39 733.527 744.469 827.414 842.54 860.366 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="5677.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="46">
2 1 1 2 16 1 1 1 1 37 2 2 2 1 2 2 1 1 1 5 7 2 1 15 1 2 1 2 2 3
4 3 3 5 1 3 2 31 2 1 100 3 3 4 2 5 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="14413" mh="1778.848000" z="2" expect="4.4e-017" label="SO_1630 translation elongation factor Ts (Tsf)" type="model" sumI="5.44" maxI="21889.3" fI="218.893" >
<protein expect="-137.0" id="14413.1" uid="1370" label="SO_1630 translation elongation factor Ts (Tsf)" sumI="6.79" >
<note label="description">SO_1630 translation elongation factor Ts (Tsf)</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="283">
	<domain id="14413.1.1" start="265" end="281" expect="4.4e-017" mh="1777.897" delta="0.951" hyperscore="91.8" nextscore="23.8" y_score="12.8" y_ions="14" b_score="10.9" b_ions="12" pre="GIEK" post="KA]" seq="KEEDFAAEVAAQIAASK" missed_cleavages="3">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="14413.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.63577</GAML:attribute>
<GAML:attribute type="a1">-0.239733</GAML:attribute>
<GAML:Xdata label="14413.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="94">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59
60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89
90 91 92 93 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="14413.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="94">
9301 9301 9301 9301 9301 8082 7313 5524 4214 2820 1899 1069 637 369 196 113 66 34 20 11 3 0 8 0 7 0 0 0 0 0
0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
0 0 6 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="14413.convolute" type="convolution survival function">
<GAML:Xdata label="14413.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="15">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="14413.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="15">
9309 9309 9309 9309 9309 8090 7266 5258 3596 1955 932 238 45 15 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="14413.b" type="b ion histogram">
<GAML:Xdata label="14413.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="14">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="14413.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="14">
3320 4488 1231 229 32 3 0 0 0 0 0 0 6 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="14413.y" type="y ion histogram">
<GAML:Xdata label="14413.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="14413.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
3014 4671 1311 263 42 1 1 0 0 0 0 0 0 0 6 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=11244 cs=2</note>
<GAML:trace id="14413" label="14413.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">1778.85</GAML:attribute>
<GAML:attribute type="charge">2</GAML:attribute>
<GAML:Xdata label="14413.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
305.133 376.336 387.236 485.304 489.322 502.284 503.317 617.442 649.319 688.417 702.288 720.385 723.659 755.229 759.438 763.477 772.708 775.099 791.385 792.398 841.462 858.413 859.58 987.545 1001.51 1019.36 1021.57 1058.5 1059.5 1062.05
1069.01 1090.48 1097.32 1119.4 1129.52 1131.48 1161.46 1197.72 1271.45 1272.55 1276.61 1278.87 1289.55 1384.72 1391.61 1402.6 1473.66 1520.62 1544.66 1649.59 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="14413.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
9 18 9 9 17 22 9 18 11 46 18 17 11 8 86 13 17 11 36 14 9 52 29 56 12 33 10 100 43 18
11 31 13 9 82 12 26 26 15 16 83 9 30 9 26 16 29 26 25 13 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="14412" mh="1778.646000" z="3" expect="2.3e-006" label="SO_1630 translation elongation factor Ts (Tsf)" type="model" sumI="5.58" maxI="49671.2" fI="496.712" >
<protein expect="-137.0" id="14412.1" uid="1370" label="SO_1630 translation elongation factor Ts (Tsf)" sumI="6.79" >
<note label="description">SO_1630 translation elongation factor Ts (Tsf)</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="283">
	<domain id="14412.1.1" start="265" end="281" expect="2.3e-006" mh="1777.897" delta="0.749" hyperscore="63.6" nextscore="31.9" y_score="10.4" y_ions="11" b_score="11.5" b_ions="14" pre="GIEK" post="KA]" seq="KEEDFAAEVAAQIAASK" missed_cleavages="3">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="14412.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.55709</GAML:attribute>
<GAML:attribute type="a1">-0.175846</GAML:attribute>
<GAML:Xdata label="14412.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="66">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59
60 61 62 63 64 65 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="14412.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="66">
13718 13718 13718 13430 13139 12459 11603 10169 8667 7028 5498 4080 2898 2000 1353 897 598 379 264 179 104 62 39 25 20 18 12 10 5 3
0 0 7 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
0 0 0 0 6 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="14412.convolute" type="convolution survival function">
<GAML:Xdata label="14412.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="14412.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
13725 13725 13725 13437 13120 12380 11307 9437 7362 4801 2268 772 129 20 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="14412.b" type="b ion histogram">
<GAML:Xdata label="14412.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="14412.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
2094 4459 3634 2080 978 328 89 48 5 3 1 0 0 0 6 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="14412.y" type="y ion histogram">
<GAML:Xdata label="14412.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="13">
0 1 2 3 4 5 6 7 8 9 10 11 12 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="14412.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="13">
3353 4816 3159 1531 605 175 73 7 0 0 0 6 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=11243 cs=3</note>
<GAML:trace id="14412" label="14412.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">1778.65</GAML:attribute>
<GAML:attribute type="charge">3</GAML:attribute>
<GAML:Xdata label="14412.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
234.187 287.179 305.166 309.25 371.546 376.223 380.415 427.23 429.769 460.921 489.377 496.337 501.37 510.357 532.117 536.712 545.762 572.525 574.751 617.461 636.934 645.184 649.231 663.431 670.448 672.688 679.647 688.27 693.026 702.041
720.275 723.322 728.368 737.311 741.474 759.327 764.134 766.832 772.831 791.59 816.526 858.491 891.285 920.448 962.229 1019.43 1033.28 1090.57 1215.59 1345.92 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="14412.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
12 5 61 3 4 19 4 3 6 15 14 6 5 49 8 8 25 5 3 14 3 14 3 9 8 3 3 49 3 63
8 15 7 100 7 45 4 3 37 8 28 4 6 32 6 14 7 3 3 8 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="15435" mh="1650.868000" z="3" expect="2.5e-002" label="SO_1630 translation elongation factor Ts (Tsf)" type="model" sumI="4.10" maxI="1098.7" fI="10.987" >
<protein expect="-137.0" id="15435.1" uid="1370" label="SO_1630 translation elongation factor Ts (Tsf)" sumI="6.79" >
<note label="description">SO_1630 translation elongation factor Ts (Tsf)</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="283">
	<domain id="15435.1.1" start="266" end="281" expect="2.5e-002" mh="1649.802" delta="1.066" hyperscore="34.2" nextscore="25.1" y_score="11.3" y_ions="8" b_score="10.4" b_ions="8" pre="IEKK" post="KA]" seq="EEDFAAEVAAQIAASK" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="15435.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">6.25959</GAML:attribute>
<GAML:attribute type="a1">-0.229915</GAML:attribute>
<GAML:Xdata label="15435.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="36">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="15435.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="36">
14379 14379 14379 14379 14379 14159 13718 12836 11363 9287 6977 4865 3198 2045 1209 736 430 237 145 84 49 27 11 6 0 5 0 0 0 0
0 0 0 0 4 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="15435.convolute" type="convolution survival function">
<GAML:Xdata label="15435.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="15435.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
14384 14384 14384 14384 14384 14164 13720 12674 10684 7333 3544 967 136 14 1 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="15435.b" type="b ion histogram">
<GAML:Xdata label="15435.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
0 1 2 3 4 5 6 7 8 9 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="15435.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
1897 4875 4138 2319 844 219 80 8 4 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="15435.y" type="y ion histogram">
<GAML:Xdata label="15435.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
0 1 2 3 4 5 6 7 8 9 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="15435.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
2966 5614 3649 1570 444 113 20 3 5 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=11825 cs=3</note>
<GAML:trace id="15435" label="15435.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">1650.87</GAML:attribute>
<GAML:attribute type="charge">3</GAML:attribute>
<GAML:Xdata label="15435.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
228.419 242.374 269.956 281.056 305.151 353.314 370.033 380.307 423.351 435.154 438.27 464.352 472.664 476.159 479.266 481.758 482.737 488.279 497.741 501.109 502.985 505.386 514.379 517.517 529.755 532.144 556.775 571.195 573.962 592.477
617.31 629.201 638.471 666.982 673.349 677.275 688.41 696.317 709.038 719.729 724.563 759.55 781.076 792.172 873.165 887.341 891.291 931.623 972.383 1161.68 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="15435.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
13 11 15 13 38 14 10 28 25 14 19 15 23 13 11 27 25 27 16 20 52 17 22 19 31 56 22 15 50 10
24 22 17 14 100 12 18 37 48 11 12 13 17 30 16 27 30 13 11 10 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="15412" mh="1650.552000" z="2" expect="2.0e-002" label="SO_1630 translation elongation factor Ts (Tsf)" type="model" sumI="4.39" maxI="1371.3" fI="13.713" >
<protein expect="-137.0" id="15412.1" uid="1370" label="SO_1630 translation elongation factor Ts (Tsf)" sumI="6.79" >
<note label="description">SO_1630 translation elongation factor Ts (Tsf)</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="283">
	<domain id="15412.1.1" start="266" end="281" expect="2.0e-002" mh="1649.802" delta="0.750" hyperscore="26.1" nextscore="20.8" y_score="11.3" y_ions="6" b_score="8.0" b_ions="3" pre="IEKK" post="KA]" seq="EEDFAAEVAAQIAASK" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="15412.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">6.60295</GAML:attribute>
<GAML:attribute type="a1">-0.318031</GAML:attribute>
<GAML:Xdata label="15412.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="28">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="15412.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="28">
10146 10146 10146 10146 10146 10146 10068 7697 6204 4124 2466 1326 725 374 166 87 26 12 6 3 0 6 0 0 0 0 4 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="15412.convolute" type="convolution survival function">
<GAML:Xdata label="15412.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="15">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="15412.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="15">
10152 10152 10152 10152 10152 10152 10074 7703 5932 3277 1177 338 60 6 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="15412.b" type="b ion histogram">
<GAML:Xdata label="15412.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="6">
0 1 2 3 4 5 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="15412.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="6">
3560 4959 1390 217 26 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="15412.y" type="y ion histogram">
<GAML:Xdata label="15412.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="8">
0 1 2 3 4 5 6 7 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="15412.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="8">
3738 4865 1326 195 24 0 4 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=11811 cs=2</note>
<GAML:trace id="15412" label="15412.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">1650.55</GAML:attribute>
<GAML:attribute type="charge">2</GAML:attribute>
<GAML:Xdata label="15412.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
305.116 497.861 575.095 617.436 667.242 679.042 688.34 705.687 724.645 726.179 759.728 774.694 792.844 794.601 799.769 845.788 858.539 863.641 865.853 873.113 875.286 893.376 901.334 914.051 916.419 931.614 935.593 962.217 973.16 983.855
988.755 991.254 992.813 1007.96 1013.64 1016.93 1027.55 1033.71 1052.21 1112.02 1115.18 1124.24 1125.56 1130.71 1139.77 1158.67 1221.49 1276.91 1345.47 1347.61 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="15412.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
28 23 28 24 28 28 47 32 25 30 49 27 50 92 24 27 100 40 38 28 25 29 26 31 29 27 42 24 36 32
67 27 28 32 32 49 30 26 46 41 24 41 28 35 36 30 26 24 51 45 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="12977" mh="2278.011000" z="3" expect="2.8e-009" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" type="model" sumI="4.92" maxI="9526.7" fI="95.267" >
<protein expect="-136.0" id="12977.1" uid="717" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" sumI="6.15" >
<note label="description">SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="1517">
    <domain id="12977.1.1" start="9" end="28" expect="2.8e-009" mh="2276.149" delta="1.862" hyperscore="71.5" nextscore="31.5" y_score="14.1" y_ions="16" b_score="12.6" b_ions="11" pre="NQPK" post="DFSL" seq="HMTQAQTPDPLFLQAEHLAK" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="12977.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.89718</GAML:attribute>
<GAML:attribute type="a1">-0.202034</GAML:attribute>
<GAML:Xdata label="12977.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="74">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59
60 61 62 63 64 65 66 67 68 69 70 71 72 73 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="12977.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="74">
13337 13337 13337 13337 13196 12677 12028 10813 9257 7321 5704 4152 2884 1904 1290 859 551 326 225 123 73 44 26 13 6 4 3 0 0 0
0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
0 0 0 0 0 0 0 0 0 0 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="12977.convolute" type="convolution survival function">
<GAML:Xdata label="12977.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="17">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="12977.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="17">
13340 13340 13340 13340 13199 12674 11928 10307 7596 4460 1808 568 87 28 3 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="12977.b" type="b ion histogram">
<GAML:Xdata label="12977.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="13">
0 1 2 3 4 5 6 7 8 9 10 11 12 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="12977.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="13">
1988 4124 3726 2147 956 279 86 28 4 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="12977.y" type="y ion histogram">
<GAML:Xdata label="12977.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="18">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="12977.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="18">
2625 4686 3418 1705 627 223 44 9 1 0 0 0 0 0 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=10431 cs=3</note>
<GAML:trace id="12977" label="12977.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">2278.01</GAML:attribute>
<GAML:attribute type="charge">3</GAML:attribute>
<GAML:Xdata label="12977.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
269.277 308.227 455.251 468.314 505.825 528.843 545.37 587.68 602.193 610.794 634.11 643.579 668.441 675.616 681.438 684.629 697.32 707.895 732.377 734.419 737.45 738.492 740.222 742.424 779.451 780.404 790.571 796.58 798.471 846.176
881.624 890.135 909.471 933.487 944.659 946.166 953.906 965.285 973.706 992.494 995.741 1004.47 1010.4 1030.17 1056.49 1065.74 1070.16 1220.56 1266.73 1478.82 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="12977.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
11 9 8 9 7 14 9 8 18 7 70 7 23 20 8 10 13 7 10 8 9 9 100 11 10 10 10 16 17 13
7 16 31 7 7 11 8 8 20 10 24 43 36 19 47 24 8 23 20 12 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="10921" mh="1385.274000" z="2" expect="2.4e-006" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" type="model" sumI="4.81" maxI="7067.4" fI="70.674" >
<protein expect="-136.0" id="10921.1" uid="717" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" sumI="6.15" >
<note label="description">SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="1517">
	<domain id="10921.1.1" start="47" end="59" expect="2.4e-006" mh="1384.743" delta="0.531" hyperscore="49.7" nextscore="22.3" y_score="12.5" y_ions="8" b_score="10.3" b_ions="8" pre="EEIK" post="DLAS" seq="GLLNDDAIQANLK" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="10921.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.41107</GAML:attribute>
<GAML:attribute type="a1">-0.221938</GAML:attribute>
<GAML:Xdata label="10921.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="52">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="10921.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="52">
11224 11224 11224 11224 10077 9010 7185 5706 4193 2702 1692 1000 527 319 174 115 76 45 27 16 0 7 4 0 0 0 0 0 0 0
0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="10921.convolute" type="convolution survival function">
<GAML:Xdata label="10921.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="10921.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
11231 11231 11231 11231 10084 8986 6964 5086 3067 1593 805 204 58 11 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="10921.b" type="b ion histogram">
<GAML:Xdata label="10921.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
0 1 2 3 4 5 6 7 8 9 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="10921.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
2928 5877 1934 408 68 14 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="10921.y" type="y ion histogram">
<GAML:Xdata label="10921.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
0 1 2 3 4 5 6 7 8 9 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="10921.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
5029 4894 1106 178 22 0 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=9259 cs=2</note>
<GAML:trace id="10921" label="10921.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">1385.27</GAML:attribute>
<GAML:attribute type="charge">2</GAML:attribute>
<GAML:Xdata label="10921.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
284.084 353.382 357.344 374.264 445.348 513.065 514.21 540.411 551.114 556.413 573.33 583.331 595.563 599.136 607.843 611.28 613.021 625.724 628.259 642.242 646.37 655.289 658.358 662.108 664.288 665.805 757.502 774.416 777.332 784.521
795.267 812.258 818.66 823.3 834.328 852.262 872.526 916.234 923.544 929.444 940.329 987.527 994.454 1011.25 1079.65 1101.42 1125.38 1214.71 1220.85 1238.51 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="10921.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
8 6 10 12 52 11 7 10 8 15 100 7 9 7 76 23 7 8 16 6 6 12 7 12 22 9 21 6 14 6
32 28 6 6 6 7 59 7 12 6 27 54 13 15 7 79 7 16 6 14 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="11249" mh="2584.446000" z="3" expect="1.5e-001" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" type="model" sumI="4.82" maxI="10524" fI="105.24" >
<protein expect="-136.0" id="11249.1" uid="717" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" sumI="6.15" >
<note label="description">SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="1517">
	<domain id="11249.1.1" start="60" end="83" expect="1.5e-001" mh="2585.357" delta="-0.911" hyperscore="28.2" nextscore="23.4" y_score="5.7" y_ions="2" b_score="12.4" b_ions="9" pre="ANLK" post="GAKR" seq="DLASLDVDGYVAKVIQPTQDKGRP" missed_cleavages="2">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="11249.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">6.10902</GAML:attribute>
<GAML:attribute type="a1">-0.246012</GAML:attribute>
<GAML:Xdata label="11249.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="30">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29

</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="11249.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="30">
12451 12451 12451 12451 12084 11747 10958 9490 7757 5779 4150 2575 1587 915 533 327 165 105 40 19 7 0 7 1 0 0 0 0 2 0

</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="11249.convolute" type="convolution survival function">
<GAML:Xdata label="11249.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="11249.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
12458 12458 12458 12458 12091 11704 10682 8468 5402 2487 814 178 40 15 1 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="11249.b" type="b ion histogram">
<GAML:Xdata label="11249.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="11">
0 1 2 3 4 5 6 7 8 9 10 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="11249.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="11">
1467 3991 4098 1997 694 180 25 4 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="11249.y" type="y ion histogram">
<GAML:Xdata label="11249.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="8">
0 1 2 3 4 5 6 7 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="11249.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="8">
2065 4545 3592 1682 467 95 12 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=9450 cs=3</note>
<GAML:trace id="11249" label="11249.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">2584.45</GAML:attribute>
<GAML:attribute type="charge">3</GAML:attribute>
<GAML:Xdata label="11249.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
597.321 615.318 671.207 696.354 714.168 739.003 747.318 753.503 755.358 772.653 774.658 780.41 790.213 792.25 798.494 801.144 804.915 808.022 811.055 813.157 817.292 820.771 823.46 826.212 829.384 832.238 835.016 838.35 840.792 844.05
983.847 989.613 1006.7 1023.61 1049.57 1103.56 1117.83 1138.28 1140.08 1146.49 1148.59 1156.48 1157.69 1160.04 1168.35 1175.5 1177.43 1201.1 1210.63 1219.75 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="11249.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
19 13 6 18 24 8 5 9 7 6 10 5 7 7 6 8 7 6 6 6 12 7 7 17 11 22 32 14 54 100
14 5 7 6 7 7 6 10 6 7 6 10 15 11 8 6 9 8 8 6 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="19079" mh="3709.860000" z="3" expect="1.3e-006" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" type="model" sumI="5.29" maxI="16742.2" fI="167.422" >
<protein expect="-136.0" id="19079.1" uid="717" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" sumI="6.15" >
<note label="description">SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="1517">
	<domain id="19079.1.1" start="149" end="183" expect="1.3e-006" mh="3710.812" delta="-0.952" hyperscore="58.9" nextscore="34.6" y_score="12.9" y_ions="15" b_score="11.2" b_ions="7" pre="KAIR" post="AIAE" seq="HFAELSMPIVYLIDTPGADAGEVANSQNQAHSISK" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="19079.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.69891</GAML:attribute>
<GAML:attribute type="a1">-0.19671</GAML:attribute>
<GAML:Xdata label="19079.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="61">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59
60 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="19079.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="61">
7869 7869 7869 7869 7869 7666 7423 6920 6119 5093 4019 2999 2164 1432 970 607 383 220 143 93 49 35 26 15 5 0 7 0 5 0
0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2
0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="19079.convolute" type="convolution survival function">
<GAML:Xdata label="19079.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="19079.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
7876 7876 7876 7876 7876 7673 7410 6793 5617 3798 1858 614 98 27 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="19079.b" type="b ion histogram">
<GAML:Xdata label="19079.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
0 1 2 3 4 5 6 7 8 9 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="19079.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
1181 2549 2170 1212 485 217 50 11 1 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="19079.y" type="y ion histogram">
<GAML:Xdata label="19079.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="17">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="19079.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="17">
1312 2668 2203 1129 409 124 18 11 0 0 0 0 0 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=13870 cs=3</note>
<GAML:trace id="19079" label="19079.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">3709.86</GAML:attribute>
<GAML:attribute type="charge">3</GAML:attribute>
<GAML:Xdata label="19079.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
685.381 798.362 816.377 821.562 867.468 974.539 982.3 991.095 1026.36 1032.97 1041.54 1064.34 1099.49 1125.34 1140.04 1149.92 1156.13 1183.12 1192.32 1206.47 1213.37 1214.44 1284.49 1289.61 1290.65 1293.78 1344.5 1384.77 1402.72 1439.4
1448.39 1450.04 1514.05 1515.69 1557.41 1614.96 1629.62 1631.63 1640.75 1641.84 1669.86 1678.59 1704.91 1713.7 1714.67 1731.93 1783.07 1787.49 1981.77 1983.44 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="19079.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
19 23 48 15 13 11 13 40 9 19 59 8 31 31 8 9 32 10 9 9 27 20 14 9 17 13 10 12 26 21
88 15 40 23 40 22 38 13 32 10 9 22 18 35 100 22 11 10 21 15 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="18951" mh="3712.434000" z="3" expect="5.8e-004" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" type="model" sumI="4.55" maxI="2598.3" fI="25.983" >
<protein expect="-136.0" id="18951.1" uid="717" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" sumI="6.15" >
<note label="description">SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="1517">
	<domain id="18951.1.1" start="149" end="183" expect="5.8e-004" mh="3710.812" delta="1.622" hyperscore="44.1" nextscore="27.7" y_score="12.2" y_ions="12" b_score="10.9" b_ions="6" pre="KAIR" post="AIAE" seq="HFAELSMPIVYLIDTPGADAGEVANSQNQAHSISK" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="18951.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.81686</GAML:attribute>
<GAML:attribute type="a1">-0.205499</GAML:attribute>
<GAML:Xdata label="18951.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="46">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="18951.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="46">
7864 7864 7864 7864 7864 7864 7447 7054 6274 5240 4187 3065 2217 1453 991 604 359 231 121 84 44 24 19 16 8 7 2 0 3 0
0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="18951.convolute" type="convolution survival function">
<GAML:Xdata label="18951.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="18951.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
7867 7867 7867 7867 7867 7867 7450 6996 5978 4264 2270 812 155 34 5 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="18951.b" type="b ion histogram">
<GAML:Xdata label="18951.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
0 1 2 3 4 5 6 7 8 9 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="18951.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
1325 2724 2145 1069 436 129 27 8 4 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="18951.y" type="y ion histogram">
<GAML:Xdata label="18951.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="14">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="18951.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="14">
1368 2612 2102 1133 453 144 41 9 1 2 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=13799 cs=3</note>
<GAML:trace id="18951" label="18951.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">3712.43</GAML:attribute>
<GAML:attribute type="charge">3</GAML:attribute>
<GAML:Xdata label="18951.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
798.313 816.372 821.126 884.394 899.655 915.127 983.221 991.87 1041.87 1099.5 1125.46 1126.75 1139.76 1156.23 1166.45 1183.04 1185.85 1189.73 1195.68 1198.17 1210.05 1212.46 1213.46 1215.08 1284.61 1294.56 1384.72 1401.43 1402.97 1431.54
1440.12 1449.34 1514.64 1515.72 1519.35 1552.67 1557.76 1561.26 1569.63 1612.17 1614.87 1629.68 1640.6 1641.72 1679.61 1714.6 1731.81 1767.37 1787.79 1982.92 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="18951.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
17 28 17 15 16 15 18 32 76 43 23 22 19 35 26 17 18 15 22 17 17 35 22 53 22 23 20 21 14 20
21 100 40 30 17 15 41 17 18 15 46 26 24 18 25 71 25 14 18 25 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="12494" mh="1262.023000" z="2" expect="2.2e-003" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" type="model" sumI="5.05" maxI="12093.4" fI="120.934" >
<protein expect="-136.0" id="12494.1" uid="717" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" sumI="6.15" >
<note label="description">SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="1517">
	<domain id="12494.1.1" start="474" end="484" expect="2.2e-003" mh="1261.726" delta="0.297" hyperscore="36.9" nextscore="22.0" y_score="12.2" y_ions="7" b_score="12.9" b_ions="5" pre="NNFK" post="SVTQ" seq="GLIQHLENLPK" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="12494.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.52887</GAML:attribute>
<GAML:attribute type="a1">-0.221766</GAML:attribute>
<GAML:Xdata label="12494.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="39">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="12494.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="39">
11338 11338 11338 11338 10152 9105 7254 5856 4324 3086 2117 1345 910 546 286 163 94 52 36 17 10 5 4 0 0 0 0 0 0 0
0 0 0 0 0 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="12494.convolute" type="convolution survival function">
<GAML:Xdata label="12494.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="18">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="12494.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="18">
11340 11340 11340 11340 10154 9075 7037 5274 3299 2044 1137 593 262 75 19 9 1 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="12494.b" type="b ion histogram">
<GAML:Xdata label="12494.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="7">
0 1 2 3 4 5 6 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="12494.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="7">
3572 5679 1676 350 61 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="12494.y" type="y ion histogram">
<GAML:Xdata label="12494.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="9">
0 1 2 3 4 5 6 7 8 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="12494.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="9">
3784 5673 1557 299 24 1 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=10155 cs=2</note>
<GAML:trace id="12494" label="12494.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">1262.02</GAML:attribute>
<GAML:attribute type="charge">2</GAML:attribute>
<GAML:Xdata label="12494.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
226.068 244.188 357.121 400.312 425.719 460.726 471.36 472.797 474.368 480.824 489.75 513.393 521.314 528.778 532.044 535.743 543.917 546.366 549.337 558.322 587.412 592.054 594.233 595.756 600.448 601.441 602.97 605.228 662.484 663.455
667.966 711.053 713.472 718.518 730.671 774.926 777.521 791.439 822.614 830.625 833.731 850.48 905.525 919.571 961.495 978.583 990.541 1001.52 1002.61 1018.48 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="12494.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
9 39 12 11 11 7 22 7 9 46 8 36 7 7 9 7 9 59 21 6 19 7 7 8 30 9 7 9 16 10
6 6 44 6 5 6 8 37 5 16 7 100 22 10 22 42 9 17 5 99 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="3739" mh="1616.496000" z="2" expect="3.4e-007" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" type="model" sumI="5.09" maxI="12868.5" fI="128.685" >
<protein expect="-136.0" id="3739.1" uid="717" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" sumI="6.15" >
<note label="description">SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="1517">
	<domain id="3739.1.1" start="558" end="572" expect="3.4e-007" mh="1615.756" delta="0.740" hyperscore="57.2" nextscore="23.3" y_score="11.5" y_ions="8" b_score="11.1" b_ions="10" pre="LLHK" post="AKFY" seq="SIDHALSTQDTANDK" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="3739.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.05512</GAML:attribute>
<GAML:attribute type="a1">-0.201487</GAML:attribute>
<GAML:Xdata label="3739.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="59">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="3739.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="59">
9260 9260 9260 9260 8857 7402 5835 4293 2771 1796 1151 696 438 258 171 97 70 47 26 7 2 0 0 4 0 0 0 0 0 0
0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="3739.convolute" type="convolution survival function">
<GAML:Xdata label="3739.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="3739.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
9264 9264 9264 9264 8861 7406 5712 3860 2030 965 426 134 39 10 1 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="3739.b" type="b ion histogram">
<GAML:Xdata label="3739.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="12">
0 1 2 3 4 5 6 7 8 9 10 11 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="3739.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="12">
2899 4803 1227 273 48 12 0 0 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="3739.y" type="y ion histogram">
<GAML:Xdata label="3739.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
0 1 2 3 4 5 6 7 8 9 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="3739.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
4090 3991 968 180 29 4 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=5005 cs=2</note>
<GAML:trace id="3739" label="3739.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">1616.5</GAML:attribute>
<GAML:attribute type="charge">2</GAML:attribute>
<GAML:Xdata label="3739.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
253.073 324.274 376.286 425.389 447.451 453.273 496.23 506.417 524.31 548.348 575.34 609.63 619.358 627.051 637.354 638.315 642.195 651.12 663.298 691.003 694.006 700.231 706.264 708.366 724.398 751.143 763.928 765.334 774.253 782.653
892.431 935.499 953.493 961.76 979.348 981.603 984.457 1050.43 1068.34 1074.78 1092.47 1094.51 1146.44 1151.57 1163.43 1165.5 1169.57 1240.46 1354.57 1469.51 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="3739.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
6 11 8 6 9 19 10 15 66 44 9 11 14 7 54 17 10 50 14 8 7 10 10 25 22 9 8 7 9 12
34 8 7 7 100 10 9 8 38 9 88 12 7 7 57 13 8 13 9 17 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="21270" mh="3577.563000" z="3" expect="5.1e-006" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" type="model" sumI="4.86" maxI="4514.9" fI="45.149" >
<protein expect="-136.0" id="21270.1" uid="717" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" sumI="6.15" >
<note label="description">SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="1517">
	<domain id="21270.1.1" start="872" end="905" expect="5.1e-006" mh="3575.770" delta="1.793" hyperscore="51.6" nextscore="28.3" y_score="13.8" y_ions="7" b_score="14.2" b_ions="11" pre="YLSK" post="INEV" seq="VPGAMAGLVHNPFSENLDNQLASIDPLMPMPTAK" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="21270.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">6.18139</GAML:attribute>
<GAML:attribute type="a1">-0.222493</GAML:attribute>
<GAML:Xdata label="21270.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="54">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="21270.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="54">
8318 8318 8318 8318 8318 8318 8027 7746 7196 6145 5089 3869 2840 1923 1285 845 510 320 199 102 43 21 10 2 0 11 1 0 3 0
0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="21270.convolute" type="convolution survival function">
<GAML:Xdata label="21270.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="17">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="21270.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="17">
8329 8329 8329 8329 8329 8329 8038 7724 6994 5501 3416 1388 287 62 8 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="21270.b" type="b ion histogram">
<GAML:Xdata label="21270.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="13">
0 1 2 3 4 5 6 7 8 9 10 11 12 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="21270.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="13">
1205 2799 2350 1328 446 159 37 2 0 1 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="21270.y" type="y ion histogram">
<GAML:Xdata label="21270.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="9">
0 1 2 3 4 5 6 7 8 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="21270.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="9">
1288 2770 2338 1291 476 136 21 9 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=15101 cs=3</note>
<GAML:trace id="21270" label="21270.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">3577.56</GAML:attribute>
<GAML:attribute type="charge">3</GAML:attribute>
<GAML:Xdata label="21270.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
644.407 775.483 848.5 849.546 868.038 962.677 985.463 986.434 1038.31 1045.3 1047.04 1054.36 1077.2 1080.73 1089.43 1095.2 1100.46 1103.56 1130.09 1138.8 1151.36 1152.88 1158.4 1160 1161.82 1164.97 1167.93 1173.14 1230.1 1238.88
1246.84 1257.29 1291.82 1296.26 1297.83 1300.64 1302.67 1306.44 1319.04 1358.18 1371.65 1401.24 1405.57 1458.89 1468.12 1484.42 1533.61 1580.64 1607.81 1850.06 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="21270.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
61 25 38 28 20 16 75 48 23 20 35 24 18 20 23 22 100 48 46 65 16 16 23 18 18 30 17 20 34 31
19 16 20 97 32 67 22 18 15 16 53 35 18 42 56 25 27 33 18 17 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="24308" mh="3205.592000" z="3" expect="2.6e-005" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" type="model" sumI="4.64" maxI="3068.6" fI="30.686" >
<protein expect="-136.0" id="24308.1" uid="717" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" sumI="6.15" >
<note label="description">SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="1517">
	<domain id="24308.1.1" start="906" end="934" expect="2.6e-005" mh="3204.663" delta="0.929" hyperscore="57.6" nextscore="31.5" y_score="12.9" y_ions="11" b_score="12.2" b_ions="11" pre="PTAK" post="KLMK" seq="INEVIINALSTLVVEAPAEEEEIVQNDPR" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="24308.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.54616</GAML:attribute>
<GAML:attribute type="a1">-0.175841</GAML:attribute>
<GAML:Xdata label="24308.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="60">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59

</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="24308.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="60">
9650 9650 9650 9650 9650 9561 9175 8609 7742 6473 5238 3775 2699 1824 1238 807 556 370 253 170 115 64 49 31 20 10 1 0 11 6
3 2 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0

</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="24308.convolute" type="convolution survival function">
<GAML:Xdata label="24308.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="24308.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
9661 9661 9661 9661 9661 9572 9186 8535 7360 5379 3078 1246 254 61 7 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="24308.b" type="b ion histogram">
<GAML:Xdata label="24308.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="13">
0 1 2 3 4 5 6 7 8 9 10 11 12 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="24308.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="13">
1744 3452 2419 1253 555 168 42 20 5 0 0 3 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="24308.y" type="y ion histogram">
<GAML:Xdata label="24308.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="13">
0 1 2 3 4 5 6 7 8 9 10 11 12 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="24308.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="13">
1561 3251 2619 1455 554 174 31 9 4 0 0 3 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=16805 cs=3</note>
<GAML:trace id="24308" label="24308.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">3205.59</GAML:attribute>
<GAML:attribute type="charge">3</GAML:attribute>
<GAML:Xdata label="24308.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
629.217 682.28 690.848 728.554 763.79 798.935 841.339 850.208 863.7 867.352 913.148 962.733 980.486 1003.11 1018.8 1024.47 1032.5 1042.15 1047.74 1050.39 1147.02 1150.52 1168.55 1196.5 1212.77 1239.69 1248.03 1254.36 1263.54 1267.04
1271.01 1281.54 1304.48 1318.58 1324.56 1327.91 1362.74 1364.81 1380.57 1381.53 1409.98 1454.77 1479.44 1509.49 1525.69 1591.56 1608.6 1610.83 1661.65 1679.91 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="24308.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
30 14 17 39 53 89 15 13 58 30 100 58 29 13 27 14 14 19 14 15 29 14 15 24 24 17 25 24 23 18
15 38 19 18 18 13 17 17 76 20 16 14 73 14 34 13 63 15 15 25 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="23606" mh="3332.772000" z="3" expect="2.8e-007" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" type="model" sumI="4.50" maxI="3346.7" fI="33.467" >
<protein expect="-136.0" id="23606.1" uid="717" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" sumI="6.15" >
<note label="description">SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="1517">
	<domain id="23606.1.1" start="906" end="935" expect="2.8e-007" mh="3332.758" delta="0.014" hyperscore="68.3" nextscore="28.5" y_score="13.0" y_ions="15" b_score="8.8" b_ions="6" pre="PTAK" post="LMKP" seq="INEVIINALSTLVVEAPAEEEEIVQNDPRK" missed_cleavages="1">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="23606.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.46221</GAML:attribute>
<GAML:attribute type="a1">-0.175937</GAML:attribute>
<GAML:Xdata label="23606.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="70">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59
60 61 62 63 64 65 66 67 68 69 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="23606.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="70">
9491 9491 9491 9491 9292 9014 8456 7680 6589 5475 4175 3134 2175 1560 1058 737 483 309 209 138 97 61 38 25 14 7 5 2 1 0
0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
0 0 0 0 0 0 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="23606.convolute" type="convolution survival function">
<GAML:Xdata label="23606.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="23606.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
9493 9493 9493 9493 9294 9012 8364 7253 5505 3573 1843 628 166 38 4 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="23606.b" type="b ion histogram">
<GAML:Xdata label="23606.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="9">
0 1 2 3 4 5 6 7 8 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="23606.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="9">
1599 3166 2636 1396 477 163 39 17 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="23606.y" type="y ion histogram">
<GAML:Xdata label="23606.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="17">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="23606.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="17">
1411 3236 2580 1405 599 192 58 9 1 0 0 0 0 0 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=16407 cs=3</note>
<GAML:trace id="23606" label="23606.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">3332.77</GAML:attribute>
<GAML:attribute type="charge">3</GAML:attribute>
<GAML:Xdata label="23606.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
456.401 682.381 779.455 827.695 850.391 863.324 867.478 918.459 928.132 963.268 977.18 980.463 1006.41 1026.77 1050.66 1063.07 1068.81 1072.24 1076.72 1083.47 1085.43 1088.72 1090.04 1093.52 1151.45 1159.46 1177.29 1178.94 1209.06 1215.76
1220.77 1234.21 1236.15 1241.17 1246.02 1264.3 1269.23 1317.97 1326.78 1374.44 1380.67 1383.01 1399.98 1408.86 1439.59 1480.37 1489.03 1553.86 1590.93 1654.16 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="23606.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
6 6 9 17 15 24 14 11 16 9 54 12 6 54 11 7 9 6 7 33 9 8 14 7 14 15 55 6 7 9
9 46 8 6 6 8 29 10 100 11 9 96 7 7 65 16 15 15 11 7 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="19973" mh="3802.256000" z="3" expect="2.2e-001" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" type="model" sumI="5.17" maxI="25804.5" fI="258.045" >
<protein expect="-136.0" id="19973.1" uid="717" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" sumI="6.15" >
<note label="description">SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="1517">
	<domain id="19973.1.1" start="1063" end="1099" expect="2.2e-001" mh="3801.018" delta="1.238" hyperscore="33.7" nextscore="32.6" y_score="13.5" y_ions="8" b_score="9.6" b_ions="7" pre="NAIK" post="AVQG" seq="TSQAQNVPVVPGSHGILTNAEQAVNVASEIGYPVLLK" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="19973.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.38392</GAML:attribute>
<GAML:attribute type="a1">-0.179288</GAML:attribute>
<GAML:Xdata label="19973.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="36">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="19973.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="36">
7724 7724 7724 7724 7488 7266 6823 6119 5165 4088 3218 2332 1677 1185 797 545 392 247 153 96 59 46 20 9 4 0 6 0 0 0
0 0 0 4 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="19973.convolute" type="convolution survival function">
<GAML:Xdata label="19973.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="19973.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
7730 7730 7730 7730 7494 7244 6635 5347 3327 1578 582 156 29 11 4 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="19973.b" type="b ion histogram">
<GAML:Xdata label="19973.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="12">
0 1 2 3 4 5 6 7 8 9 10 11 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="19973.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="12">
887 2132 2128 1475 719 304 56 21 6 0 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="19973.y" type="y ion histogram">
<GAML:Xdata label="19973.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
0 1 2 3 4 5 6 7 8 9 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="19973.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="10">
1169 2582 2108 1234 459 136 32 8 2 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=14376 cs=3</note>
<GAML:trace id="19973" label="19973.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">3802.26</GAML:attribute>
<GAML:attribute type="charge">3</GAML:attribute>
<GAML:Xdata label="19973.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
569.486 711.789 733.345 789.324 1024.6 1036.82 1065.31 1100.81 1116.74 1119.5 1134.35 1150.83 1171.76 1174.39 1189.36 1191.82 1200.99 1227.76 1231.13 1238.3 1241.44 1307.38 1316.32 1342.79 1376.01 1380.52 1389.38 1391.02 1402.69 1439.68
1450.95 1475.71 1498.16 1502.81 1507.8 1519.49 1528.52 1535.44 1537.52 1572.8 1587.53 1604.32 1609.17 1617.86 1644.19 1671.02 1699.74 1715.36 1772.57 1829.16 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="19973.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
6 6 5 14 9 6 9 5 5 6 4 7 5 5 21 7 16 4 6 5 7 7 4 11 7 11 45 11 16 9
5 5 7 7 26 6 11 18 100 7 6 7 11 32 7 5 6 14 5 8 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group id="20048" mh="1901.548000" z="2" expect="4.4e-002" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" type="model" sumI="4.88" maxI="8095.5" fI="80.955" >
<protein expect="-136.0" id="20048.1" uid="717" label="SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC" sumI="6.15" >
<note label="description">SO_0840 acetyl-CoA carboxylase multifunctional enzyme accADC</note>
<file type="peptide" URL="C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta"/>
<peptide start="1" end="1517">
	<domain id="20048.1.1" start="1082" end="1099" expect="4.4e-002" mh="1901.038" delta="0.510" hyperscore="25.1" nextscore="19.4" y_score="10.3" y_ions="7" b_score="0.0" b_ions="0" pre="ILTN" post="AVQG" seq="AEQAVNVASEIGYPVLLK" missed_cleavages="0">
</domain>
</peptide>
</protein>
<group label="supporting data" type="support">
<GAML:trace label="20048.hyper" type="hyperscore expectation function">
<GAML:attribute type="a0">5.81865</GAML:attribute>
<GAML:attribute type="a1">-0.286077</GAML:attribute>
<GAML:Xdata label="20048.hyper" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="27">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="20048.hyper" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="27">
8963 8963 8963 8963 8092 7338 5716 4338 3085 1887 1114 600 319 144 74 26 13 5 0 5 0 0 0 0 0 1 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="20048.convolute" type="convolution survival function">
<GAML:Xdata label="20048.convolute" units="score">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="20048.convolute" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="16">
8968 8968 8968 8968 8097 7323 5584 4046 2425 1117 484 144 46 17 3 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="20048.b" type="b ion histogram">
<GAML:Xdata label="20048.b" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="6">
0 1 2 3 4 5 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="20048.b" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="6">
3337 4463 1004 156 8 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
<GAML:trace label="20048.y" type="y ion histogram">
<GAML:Xdata label="20048.y" units="number of ions">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="9">
0 1 2 3 4 5 6 7 8 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="20048.y" units="counts">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="9">
3315 4481 1008 148 15 0 0 1 0 
</GAML:values>
</GAML:Ydata>
</GAML:trace>

</group>
<group type="support" label="fragment ion mass spectrum">
<note label="Description">   scan=14420 cs=2</note>
<GAML:trace id="20048" label="20048.spectrum" type="tandem mass spectrum">
<GAML:attribute type="M+H">1901.55</GAML:attribute>
<GAML:attribute type="charge">2</GAML:attribute>
<GAML:Xdata label="20048.spectrum" units="MASSTOCHARGERATIO">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
569.454 627.428 729.373 732.381 740.46 767.461 789.462 795.064 871.786 893.306 895.356 902.558 924.383 961.402 977.935 991.569 995.401 1004.99 1018.17 1024.12 1031.51 1046.39 1069.14 1078.3 1104.95 1106.46 1115.21 1118.69 1142.33 1143.37
1150.63 1160.58 1171.62 1181.28 1189.64 1200.69 1219.28 1227.8 1252.74 1255.3 1256.46 1273.36 1275.55 1306.81 1342.84 1350.95 1450.54 1507.8 1535.97 1617.04 
</GAML:values>
</GAML:Xdata>
<GAML:Ydata label="20048.spectrum" units="UNKNOWN">
<GAML:values byteorder="INTEL" format="ASCII" numvalues="50">
30 75 14 28 15 5 29 7 52 6 39 14 18 6 5 7 5 39 14 100 6 6 9 41 11 7 7 7 16 20
9 11 7 19 16 22 35 5 9 9 8 49 10 12 8 6 30 5 10 23 
</GAML:values>
</GAML:Ydata>
</GAML:trace>
</group></group>
<group label="input parameters" type="parameters">
	<note type="input" label="list path, default parameters">default_input.xml</note>
	<note type="input" label="list path, taxonomy information">C:\Xtandem_WorkDir\taxonomy.xml</note>
	<note type="input" label="output, histogram column width">30</note>
	<note type="input" label="output, histograms">yes</note>
	<note type="input" label="output, log path">XTandem_Processing_Log.txt</note>
	<note type="input" label="output, maximum valid expectation value">0.5</note>
	<note type="input" label="output, message"></note>
	<note type="input" label="output, one sequence copy">yes</note>
	<note type="input" label="output, parameters">yes</note>
	<note type="input" label="output, path">C:\Xtandem_WorkDir\QC_Shew_07_02_0p5uguL-a_16Oct07_Owl_07-08-02_xt.xml</note>
	<note type="input" label="output, path hashing">no</note>
	<note type="input" label="output, performance">yes</note>
	<note type="input" label="output, proteins">yes</note>
	<note type="input" label="output, results">valid</note>
	<note type="input" label="output, sequence path"></note>
	<note type="input" label="output, sequences">yes</note>
	<note type="input" label="output, sort results by">protein</note>
	<note type="input" label="output, spectra">yes</note>
	<note type="input" label="output, xsl path">tandem-style.xsl</note>
	<note type="input" label="protein, C-terminal residue modification mass">0.0</note>
	<note type="input" label="protein, N-terminal residue modification mass">0.0</note>
	<note type="input" label="protein, cleavage C-terminal mass change">+17.002735</note>
	<note type="input" label="protein, cleavage N-terminal mass change">+1.007825</note>
	<note type="input" label="protein, cleavage semi">yes</note>
	<note type="input" label="protein, cleavage site">[RK]|{P}</note>
	<note type="input" label="protein, homolog management">no</note>
	<note type="input" label="protein, modified residue mass file"></note>
	<note type="input" label="protein, taxon">Shewanella_oneidensis_MR-1</note>
	<note type="input" label="refine">yes</note>
	<note type="input" label="refine, maximum valid expectation value">0.5</note>
	<note type="input" label="refine, modification mass"></note>
	<note type="input" label="refine, point mutations">no</note>
	<note type="input" label="refine, potential C-terminus modifications"></note>
	<note type="input" label="refine, potential N-terminus modifications"></note>
	<note type="input" label="refine, potential modification mass"></note>
	<note type="input" label="refine, potential modification motif"></note>
	<note type="input" label="refine, sequence path"></note>
	<note type="input" label="refine, spectrum synthesis">yes</note>
	<note type="input" label="refine, tic percent">1</note>
	<note type="input" label="refine, unanticipated cleavage">yes</note>
	<note type="input" label="refine, use potential modifications for full refinement">no</note>
	<note type="input" label="residue, modification mass"></note>
	<note type="input" label="residue, potential modification mass"></note>
	<note type="input" label="residue, potential modification motif"></note>
	<note type="input" label="scoring, a ions">no</note>
	<note type="input" label="scoring, b ions">yes</note>
	<note type="input" label="scoring, c ions">no</note>
	<note type="input" label="scoring, cyclic permutation">no</note>
	<note type="input" label="scoring, include reverse">no</note>
	<note type="input" label="scoring, maximum missed cleavage sites">3</note>
	<note type="input" label="scoring, minimum ion count">4</note>
	<note type="input" label="scoring, x ions">no</note>
	<note type="input" label="scoring, y ions">yes</note>
	<note type="input" label="scoring, z ions">no</note>
	<note type="input" label="spectrum, dynamic range">100.0</note>
	<note type="input" label="spectrum, fragment mass type">monoisotopic</note>
	<note type="input" label="spectrum, fragment monoisotopic mass error">0.4</note>
	<note type="input" label="spectrum, fragment monoisotopic mass error units">Daltons</note>
	<note type="input" label="spectrum, maximum parent charge">4</note>
	<note type="input" label="spectrum, minimum fragment mz">150.0</note>
	<note type="input" label="spectrum, minimum parent m+h">500.0</note>
	<note type="input" label="spectrum, minimum peaks">15</note>
	<note type="input" label="spectrum, parent monoisotopic mass error minus">2.0</note>
	<note type="input" label="spectrum, parent monoisotopic mass error plus">2.0</note>
	<note type="input" label="spectrum, parent monoisotopic mass error units">Daltons</note>
	<note type="input" label="spectrum, parent monoisotopic mass isotope error">no</note>
	<note type="input" label="spectrum, path">C:\Xtandem_WorkDir\QC_Shew_07_02_0p5uguL-a_16Oct07_Owl_07-08-02_dta.txt</note>
	<note type="input" label="spectrum, sequence batch size">100</note>
	<note type="input" label="spectrum, threads">2</note>
	<note type="input" label="spectrum, total peaks">50</note>
	<note type="input" label="spectrum, use noise suppression">no</note>
</group>
<group label="unused input parameters"  type="parameters">
	<note type="input" label="scoring, pluggable scoring">no</note>
</group>
<group label="performance parameters" type="parameters">
	<note label="list path, sequence source #1">C:\DMS_Temp_Org\ID_001140_4BD5AF39.fasta</note>
	<note label="modelling, estimated false positives">1659</note>
	<note label="modelling, total peptides used">1334076200</note>
	<note label="modelling, total proteins used">4198</note>
	<note label="modelling, total spectra assigned">6388</note>
	<note label="modelling, total spectra used">29718</note>
	<note label="modelling, total unique assigned">4978</note>
	<note label="process, start time">2007:10:16:18:24:52</note>
	<note label="process, version">x! tandem 2007.01.01.2</note>
	<note label="quality values">3125 1793 754 409 315 274 278 182 185 169 150 153 117 141 116 100 96 65 60 54</note>
	<note label="refining, # input models">1789</note>
	<note label="refining, # input spectra">24242</note>
	<note label="refining, # partial cleavage">23</note>
	<note label="refining, # point mutations">0</note>
	<note label="refining, # potential C-terminii">0</note>
	<note label="refining, # potential N-terminii">0</note>
	<note label="refining, # unanticipated cleavage">1411</note>
	<note label="timing, initial modelling total (sec)">1594.86</note>
	<note label="timing, initial modelling/spectrum (sec)">0.054</note>
	<note label="timing, load sequence models (sec)">0.08</note>
	<note label="timing, refinement/spectrum (sec)">0.123</note>
</group>
</bioml>
